SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001883596.1.58555 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_001883596.1.58555
Domain Number - Region: 143-189
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000127
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001883596.1.58555
Sequence length 311
Comment predicted protein [Laccaria bicolor S238N-H82]; AA=GCF_000143565.1; RF=representative genome; TAX=486041; STAX=29883; NAME=Laccaria bicolor S238N-H82; strain=S238N-H82; AL=Scaffold; RT=Major
Sequence
MYASLFNSEAFLAATLFFERLIQKEEHVCTLIKTCQDDPTLSLDLHLILEAVATEKRLES
KLGYKDENVLSLHHMVTTAIAAAIRHGILNTIRDCDKLPAIPDYIPSHFAGRGIIQYFEK
FDAEIHSYGKKFPTSPRITAYHPYRRTPTPRCSKCKKMGHIRKNCSDYQCGGCLWWGPGH
TTPNCETKKKSDKAWEWEKNMRPAGYDTTTGTQMWKKKTYDWTGVPILRNEDWYTPRKQP
EFVDLTSPSPPSSPPFSPSMPPLAPPTPPSSPLYNPYSPTTHPSPLFDLEDLVSDFDSVT
SSSGNIGDIEV
Download sequence
Identical sequences B0DHZ8
29883.JGI329430 XP_001883596.1.58555 jgi|Lacbi1|329430|fgenesh3_pg.C_scaffold_21000147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]