SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001927085.1.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001927085.1.46622
Domain Number 1 Region: 33-114
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000753
Family Growth factor receptor domain 0.0057
Further Details:      
 
Domain Number 2 Region: 207-250
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000235
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001927085.1.46622
Sequence length 358
Comment protein NOV homolog [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MQRAQSLRLGLPKRCLCLAFLLLHLLGQVAATQRCPPSCPAPCPKKPPTCAPGVRAVLDD
CSCCLVCARQRGESCSVMLPCEESRGLFCDRRADPSAQTGICMAIEGDNCVFDGVIYQSG
ETFQPSCKYQCACQDGQVGCVPRCEEDLLLPQPDCPAPRKVKVPGECCEKWICDSNETGT
LGDLQTLPAYRTEATVGVAISDSGTNCIEQTTEWSACSKSCGMGFSTRVTNRNPHCEMVK
QTRLCLVRPCDQEHTQPTDKKGKKCLRTTKSLKAIHLQFENCTSLHTYRPRFCGVCSDGR
CCTPHSTKTIRVQFRCSPGKTIQKPVMVIGTCTCHNNCPHNNASFLQDLKPNTSRGEM
Download sequence
Identical sequences F1S279
ENSSSCP00000006411 XP_001927085.1.46622 9823.ENSSSCP00000006411 ENSSSCP00000006411 ENSSSCP00000030721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]