SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001929699.1.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_001929699.1.46622
Domain Number - Region: 204-252
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0392
Family TSP-1 type 1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001929699.1.46622
Sequence length 341
Comment protein MENT [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MVPAADALLWALLLLSLGPRAAAGAQGLTSTATQRDSFRFGGPLTRTYRTTARSRIPPRV
RVTMEDEDDVVAVADRLAGPAAAELLASTVSTGGQSRLSAEEDGSLEEGVVIYARRNDTS
LETPITTSNTAGGPTPIFTANGQDPEIKMSSSPLPSTWKAAADLSASDNTLNQWSRAGST
RNRWPPPSPTAMPAPEDLQLVLMPWGPWHCHCKSGTMSRTRAGKLHGLSGRLRVGALSQL
RTEHRPCTYHQCPCNRDREECPLDKGLCPDTSCTTTQTTTRATTTTTFPPLVPRLRPTPF
PSPGPSPALAFWKRVRIGLEDIWNSLSSVFTEMQPINRNQR
Download sequence
Identical sequences ENSSSCP00000007080 9823.ENSSSCP00000007080 ENSSSCP00000007080 XP_001929699.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]