SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002005619.1.58863 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002005619.1.58863
Domain Number 1 Region: 6-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.66e-108
Family Capz alpha-1 subunit 0.0000000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002005619.1.58863
Sequence length 286
Comment uncharacterized protein Dmoj_GI18973 [Drosophila mojavensis]; AA=GCF_000005175.2; RF=representative genome; TAX=7230; STAX=7230; NAME=Drosophila mojavensis; strain=TSC#15081-1352.22; AL=Scaffold; RT=Major
Sequence
MEQTQITDAEKVRIVSEFILHAPPGEFNEVFNDVRELLKNDSLLKDGASHAFSQYNKDQL
TPVRVEGSEHNAIISEYNDLGNGRFFDPRTKQSFKYDHLRKEASDYQDLKADANAESWRA
ALDLATLAYTANHYRHGVCSVFGKSQGNQITLTICIEDHQFQPKNYWNGRWRSQWHVSFQ
PGCGLAELKGVLKVQVHYYEDGNVQLVSSKDCRESVVVSNEQQLANEVIRLIEEAENEYQ
LAISENYQTMSDTTFKAMRRQLPITKTKIDWSKIVSYSIGKELKTQ
Download sequence
Identical sequences B4KT34
XP_002005619.1.58863 FBpp0168190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]