SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002032403.1.34323 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002032403.1.34323
Domain Number 1 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 2.62e-18
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0002
Further Details:      
 
Domain Number 2 Region: 52-102
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 3.4e-17
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002032403.1.34323
Sequence length 106
Comment GM23533 [Drosophila sechellia]; AA=GCF_000005215.3; RF=representative genome; TAX=7238; STAX=7238; NAME=Drosophila sechellia; strain=Rob3c; AL=Scaffold; RT=Major
Sequence
MSYQLYRNTTLGNTLQESLDELIQYGQITPGLAFKVLLQFDKSINNALNQRVKARVTFKA
GKLNTYRFCDNVWTLMLNDVEFREVHEFVKVDKVKIVACDGKSGEF
Download sequence
Identical sequences A0A1W4U8J5 B3P8D1 B4HFZ6 B4PNZ0 B4R261
FBpp0216747 FBpp0130943 XP_001982085.1.56816 XP_002032403.1.34323 XP_002098488.1.41174 XP_002104615.1.80810 XP_016932629.1.48971 XP_016949817.1.21709 XP_017008780.1.47939 XP_017040205.1.74164 XP_017083968.1.81094 XP_017112259.1.32376 FBpp0205010 FBpp0268924 7245.FBpp0268924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]