SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002056136.1.90633 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002056136.1.90633
Domain Number 1 Region: 6-254
Classification Level Classification E-value
Superfamily CutC-like 1.44e-58
Family CutC-like 0.000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002056136.1.90633
Sequence length 260
Comment uncharacterized protein Dvir_GJ10389 [Drosophila virilis]; AA=GCF_000005245.1; RF=representative genome; TAX=7244; STAX=7244; NAME=Drosophila virilis; strain=TSC#15010-1051.87; AL=Scaffold; RT=Major
Sequence
MSAHDIKLEVCVDSIKSAFAAEEGGAARIELCAALQEGGLTPTTGTLKTLKELPFTLPIH
CMLRPRRGTDFVYSEEEMQAVQTDMDLLRTHGADGFVFGALTPERTIDVDKCRRVMERSC
GLPVTFHRAFDLTDPKLMHENVQLLKELGFKRVLSSGFRATAAEGVDSLAQLIAKHHRDI
IIMPGAGIKVANLEEILTFSRCQEFHASALDTASEDYSAPTTTRMECDVTMGKQDIDPYY
GTNVYVVRKMVAIASAMSCR
Download sequence
Identical sequences B4M6H2
FBpp0224806 7244.FBpp0224806 XP_002056136.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]