SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002068092.1.14588 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002068092.1.14588
Domain Number 1 Region: 320-439
Classification Level Classification E-value
Superfamily TPR-like 2.14e-16
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002068092.1.14588
Sequence length 477
Comment uncharacterized protein Dwil_GK12366 [Drosophila willistoni]; AA=GCF_000005925.1; RF=representative genome; TAX=7260; STAX=7260; NAME=Drosophila willistoni; strain=TSC#14030-0811.24; AL=Scaffold; RT=Major
Sequence
MSNLSEYFANDPPSFFDELTPTKPNTKEQEPEPRPSGGSTMLSSGFTGGFQPPEYVEITE
TDDGGIKVSEDVRNFWELPSEQNKLIMPGIHIQGDLPDPIAIAVSQHLDEAELQHRKILC
VDDVTQDERGLKMLIHASCFRSAVNLSGRLLTIYGQGYGRSGQPAKHSPHSLQLWFTRLA
LLAKLGEYELLQAEAEPFGSHLNGPDVFFEHYPEMYNGKTGSIACFSFRLLIAELPTYLG
KPHLALDRLSELYVTCKEIREHFIALNDSPAGEFWLIRGEMVLHSIVNCALMMKKFSMID
DIISGILLTRSSLTKDEQRSLYSAWGRIYLQIGDIFGAEQKFAVARRLREMNSNPDLRDL
VDKGLIAVAKNDFPEAYLIFQKALHLDSGNTMILNNMGVCLLYAGKLKDAITLYERAINL
NPQKSLNESLLVNLSTLYELESNNSKTKKLNLLRLINRFKPDLNISIEICLKLQAGN
Download sequence
Identical sequences B4N4K4
XP_002068092.1.14588 7260.FBpp0241509 FBpp0241509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]