SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002104424.1.80810 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002104424.1.80810
Domain Number 1 Region: 285-366
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.37e-17
Family PCI domain (PINT motif) 0.062
Further Details:      
 
Weak hits

Sequence:  XP_002104424.1.80810
Domain Number - Region: 84-213
Classification Level Classification E-value
Superfamily TPR-like 0.0129
Family Tetratricopeptide repeat (TPR) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002104424.1.80810
Sequence length 389
Comment uncharacterized protein Dsimw501_GD18456 [Drosophila simulans]; AA=GCF_000754195.2; RF=representative genome; TAX=7240; STAX=7240; NAME=Drosophila simulans; strain=w501; AL=Chromosome; RT=Minor
Sequence
MPAENLEEQGLEKNPNLELAQTKFLLTLAEYKQDAALKAKLLEAIRTENMAPWYEHICSE
LGWTVDKDLLARMKENNRVEVEQLDAAIEDAEKNLGEMEVREANLKKSEYLCRIGDKAAA
ETAFRKTYEKTVSLGHRLDIVFHLIRLGLFYLDHDLITRNIDKAKYLIEEGGDWDRRNRL
KVYQGVYSVAVRDFKAAATFFLDTVSTFTSYELMDYPTFVRYTVYVAMIALPRNELRDKV
IKGSEIQEVLHGLPDVKQFLFSLYNCQYENFYVHLAGVEKQLRLDYLIHPHYRYYVREMR
ILGYTQLLESYRSLTLQYMAESFGVTVEYIDQELARFIAAGRLHAKVDRVGGIVETNRPD
NKNWQYQATIKQGDLLLNRIQKLSRVINI
Download sequence
Identical sequences B4R021 Q9V3G7
FBpp0083687 7227.FBpp0083687 FBpp0083687 FBpp0216858 NP_651048.1.81976 XP_002104424.1.80810 FBpp0083687 7300859___KOG0687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]