SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002108612.1.101920 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002108612.1.101920
Domain Number - Region: 92-184
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 0.0523
Family Helical scaffold and wing domains of SecA 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002108612.1.101920
Sequence length 371
Comment hypothetical protein TRIADDRAFT_51696 [Trichoplax adhaerens]; AA=GCF_000150275.1; RF=representative genome; TAX=10228; STAX=10228; NAME=Trichoplax adhaerens; strain=Grell-BS-1999; AL=Scaffold; RT=Major
Sequence
MTLSRIYKNKRKLKRHSVDASLIVPNINQKASDKDQLIFTGAFQLYQSNVYAGVCGVAEL
PLPATLHILSQSFESGDTITAFHILKGNRSHTAQTLSQQQLYQAIKDTSRLSKDHSAAWR
QIWHPRLAVTSFNGIGNHRNKMAKKTIRYYLLSMYSLDGNNNNNTFHRRAFVSQLDLAWK
NSLNYTCYDAPMTMYNEKLWPYSLTNMPRLKKLFKAWRYALRKGGCDQFFNRGLPSFNLG
MLLSLIGLKFASNQLQLPMKSIIKLKDDVYLENLYYNGSYVDVNVVKGKFIEVSSFLSER
KHPLFACDASCSSIDLIGWFLSYIGFVTKFIGPPLFYLSFLSCNQIHFMRFICAYVSAFM
SRERYTEIDVW
Download sequence
Identical sequences B3RKI8
XP_002108612.1.101920 10228.JGI51696 jgi|Triad1|51696|fgeneshTA2_pg.C_scaffold_1000443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]