SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002175915.1.46972 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002175915.1.46972
Domain Number 1 Region: 368-562
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.02e-43
Family Pyruvate oxidase and decarboxylase PP module 0.00000557
Further Details:      
 
Domain Number 2 Region: 6-181
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.21e-38
Family Pyruvate oxidase and decarboxylase Pyr module 0.000002
Further Details:      
 
Domain Number 3 Region: 172-344
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.45e-33
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000279
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002175915.1.46972
Sequence length 571
Comment pyruvate decarboxylase [Schizosaccharomyces japonicus yFS275]; AA=GCF_000149845.2; RF=representative genome; TAX=402676; STAX=4897; NAME=Schizosaccharomyces japonicus yFS275; strain=yFS275; AL=Scaffold; RT=Major
Sequence
MSSEKILVGEYLFQRLLQLGIKSILGVPGDFNLALLDLIDKVGDETFRWVGNANELNGAY
AADGYARVKGISAIITTFGVGELSALNGIAGCMSERIPVVHIVGVPSTKNQAVKPLLHHT
LGDGDFKVFERMSAEISAEVQFLDSAETAPQKIDHILETCWREKKPVYLAIPSDSGYFSC
DASGLKTPLNLSYPENCPVAEAEALKEIVSRINSAKKTAILVDACVSRFDAKEETQALVD
ATHFPTYVTPMGKTAINESSPYFDGVYVGSLTETDVKERLESADLLLNVGALRSDFNTGT
FTYGTPVTNTIELHSTWTQIGTAKYENVGMKALLPKIIAALDLKAVQAKAAPVNFKVPTP
TAAEGYPAGTITQKWFWPTLSTFLKDSDVVVTETGTSNFGSLDCRMPKNATHLSQVLWGA
IGWSVGALFGACLAVKDSDKPDRRTVLIVGDGSLALTVQEISTCIRQGLKPIIFVINNNG
YTIERLIHGLHAVYNDINTEWNYQNLLKDYGAKDSRSYNIHTEKELVELFQNKEFAAADV
IQLVEVHMPLLDAPRVLVEQAKLTAAINKRV
Download sequence
Identical sequences B6K7W8
SJAG_04842T0 XP_002175915.1.46972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]