SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002185772.1.39622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002185772.1.39622
Domain Number - Region: 6-52
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 0.000497
Family GIY-YIG endonuclease 0.014
Further Details:      
 
Domain Number - Region: 290-326
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000508
Family Retrovirus zinc finger-like domains 0.0055
Further Details:      
 
Domain Number - Region: 96-131
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000912
Family Retrovirus zinc finger-like domains 0.0056
Further Details:      
 
Domain Number - Region: 152-181
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0568
Family Retrovirus zinc finger-like domains 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002185772.1.39622
Sequence length 336
Comment predicted protein [Phaeodactylum tricornutum CCAP 1055/1]; AA=GCF_000150955.2; RF=representative genome; TAX=556484; STAX=2850; NAME=Phaeodactylum tricornutum CCAP 1055/1; strain=CCAP 1055/1; AL=Chromosome; RT=Major
Sequence
MPNSYTIYTLSLEGGCYYVGSTSRTMSERFQEHQAGTGSSWTRLHPPIKIRKSYRYHGPS
PGLEEDREVYELMKDVGIDKVRGGQFVQLIFTEETKRSLQRTLRHSVGACMRCGRQGHVI
LACRAVTDLYGTVIPRPSETNRSTHKSEVRSTVTQKPRARTVNSKTCARCGRSSHDENRC
YATTHSSGRVLESEENEMEPMPRRAVAQKPRARKVDSKTCARCGRSTHDESRCYATTHSS
GRVLESEEDEMEPMPRRAVAQKPRARTVNSKTCARCGRSTHDESRCYATTHSSGRVLESE
EDESDDEDFFCSRCGRSGHDAEECYARSDANGRRLW
Download sequence
Identical sequences B5Y438
2850.JGI46889 jgi|Phatr2|46889|estExt_fgenesh1_pg.C_chr_110298 XP_002185772.1.39622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]