SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002193879.2.42559 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002193879.2.42559
Domain Number 1 Region: 630-885
Classification Level Classification E-value
Superfamily YWTD domain 6.54e-56
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 2 Region: 19-278
Classification Level Classification E-value
Superfamily YWTD domain 7.98e-54
Family YWTD domain 0.00000163
Further Details:      
 
Domain Number 3 Region: 328-562
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-49
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 4 Region: 933-1192
Classification Level Classification E-value
Superfamily YWTD domain 9.29e-40
Family YWTD domain 0.0000414
Further Details:      
 
Domain Number 5 Region: 887-935
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000102
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1244-1284
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 1323-1361
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000235
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 585-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000247
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 9 Region: 1285-1321
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 281-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000427
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 11 Region: 1202-1255
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000143
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002193879.2.42559
Sequence length 1610
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 [Taeniopygia guttata]; AA=GCF_000151805.1; RF=representative genome; TAX=59729; STAX=59729; NAME=Taeniopygia guttata; AL=Chromosome; RT=Major
Sequence
MLTPLSVCPPVSVLCAAAPLLLYANRRDLRLVDAAHGKENATVIVGGLEDAAAVDFVFLK
GLIYWSDVSEEAIKRTEFNKSGSIQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIELS
NLDGSLRKVLFWQELDQPRAIALDPARGFMYWTDWGEAPKIERAGMDGSSRSIIVNTDIY
WPNGLTLDYEEQKLYWADAKLNFIHKSNLDGSHRQAVVKGSLPHPFALTLFGDTLYWTDW
NTHSILACSKYSGEDLREIHSNIFSPMDIHAFSQRRQPNATNPCGTNNGGCSHLCLMSPT
KPSYQCACPTGVKLLENGKTCKDGATALLLLARRTDLRRISLDTPDFTDIVLPLEDIRHA
IAIDFDPLEGYIYWTDDEVRAIRRSFLDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDT
GTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRI
VLVNTSLGWPNGLALDYAESKIYWGDAKTDKIEVMNADGTGRRVLVEDKLPHIFGFTLLG
DYIYWTDWQRRSIERVHKCTAEREIIIDQLPDLMGLKATNVHQIIGTNPCAEDNGGCSHL
CLYRPQGLRCACPIGLELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVK
EASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWA
DTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSE
RTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSSMLGLDREIIADDLPHPFGLTQYQ
DYIYWTDWSRRSIERANKTSGQNRTIIQAHLDYVMDILVFHSSRQAGWNECASSNGHCSH
LCLAVPVGGFVCGCPAHYSLNSDNRTCSAPTTFLLFSQKNAINRMVIDEQQSPDIILPIH
SLRNVRAIDYDPLDKQLYWIDSRQNIIRKAQEDGSQSLTVVTSPVPNQNLDMQPYDLSID
IYSRYIYWTCEATNVINVTRLDGRPMGVVLKGDQDRPRAIVVNPEKGYMYFTNLQERSPK
IERAALDGTEREVLFFSGLSKPIALAVDGQLGKLFWADSDLRRIESSDLSGANRIVLEDS
NILQPVGLTVFENWLYWIDRQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEY
RQHPCSQDNGGCSHICIVKGDGSTRCSCPVHLVLLQDELSCGEPPTCSPQQFTCFTGEID
CIPVAWRCDGFTECEDHSDEKNCPVCSDSQFQCESGQCIDSALRCNGEANCQDNSDEKNC
EVLCLTDQFRCASGQCIGKSKKCDHNLDCSDSSDEQGCYTTEEPAPQPNNTIGSIIGVIL
TVFVVGAMYFICQRVLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRG
KSVISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATERSHYTMEF
GYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRVPAAATKGYTSDLNYD
SEPVPPPPTPRSQYLSAEENCESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_002193879.2.42559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]