SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002194172.1.42559 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002194172.1.42559
Domain Number 1 Region: 87-182
Classification Level Classification E-value
Superfamily PDZ domain-like 4.86e-30
Family PDZ domain 0.015
Further Details:      
 
Domain Number 2 Region: 9-63
Classification Level Classification E-value
Superfamily L27 domain 4.71e-26
Family L27 domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002194172.1.42559
Sequence length 197
Comment PREDICTED: protein lin-7 homolog C [Taeniopygia guttata]; AA=GCF_000151805.1; RF=representative genome; TAX=59729; STAX=59729; NAME=Taeniopygia guttata; AL=Chromosome; RT=Major
Sequence
MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYET
VDISSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYIS
RIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEE
MESRFEKMRSAKRRQQN
Download sequence
Identical sequences A0A1V4JP78 A0A218UH32 G1NJI3 H0Z2T0 Q5F425
ENSTGUP00000004872 ENSMGAP00000013502 ENSTGUP00000004872 59729.ENSTGUP00000004872 9031.ENSGALP00000039371 NP_001026238.1.86415 XP_002194172.1.42559 XP_003206139.1.16129 XP_005492378.1.73095 XP_005530339.1.90289 XP_008503005.1.100939 XP_009095287.1.15306 XP_009554058.1.62272 XP_010562024.1.12557 XP_011573872.1.59079 XP_014745310.1.99236 XP_014809270.1.91963 XP_015281173.1.55130 XP_017682509.1.3805 XP_021256868.1.32913 XP_021394724.1.53032 ENSGALP00000039371 ENSGALP00000019849 ENSMGAP00000013502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]