SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002275178.2.54126 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002275178.2.54126
Domain Number 1 Region: 65-205
Classification Level Classification E-value
Superfamily PapD-like 2.15e-33
Family MSP-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002275178.2.54126
Sequence length 264
Comment PREDICTED: vesicle-associated protein 4-2 isoform X2 [Vitis vinifera]; AA=GCF_000003745.3; RF=representative genome; TAX=29760; STAX=29760; NAME=Vitis vinifera; cultivar=PN40024; AL=Chromosome; RT=Minor
Sequence
MAVPDQRSHSDGKVWGFFKLPFRGNNTITMSSSSTSHSSHLQHHHNQSNMQVEGSNLHPS
GSVSSVARSLLPTRRRLRLDPSNKLYFPYEPGKQVRSAIRIKNTSKSHVAFKFQTTAPKS
CFMRPPGAILAPGESLIATVFKFVEHPENNEKPMEQKSKVKFKIMSLKVKGPMDYVPEMF
DELKDQVAVEQILRVVFLDVERPSPALDKLKRQLAEAEAAVEARKKPPEDAGPRIIGEGL
VIDEWKERRERYLARQQVEGVDSV
Download sequence
Identical sequences D7UDP4
XP_002275178.2.54126 GSVIVT01003659001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]