SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002321417.1.11743 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002321417.1.11743
Domain Number 1 Region: 198-308
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000824
Family B3 DNA binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002321417.1.11743
Sequence length 315
Comment hypothetical protein POPTR_0015s01660g [Populus trichocarpa]; AA=GCF_000002775.3; RF=representative genome; TAX=3694; STAX=3694; NAME=Populus trichocarpa; AL=Chromosome; RT=Major
Sequence
MKNIDSSTSTVEERKKESEEEVDVLFVTEKDLKDGNIDMDAKVTGFDALVAVCHIAYKKL
KQKKREEKQKVDAILGDGKIDGPVREKALQKPMSDQVHDGSTTRKRTSEERPSCSTERYK
RNGFRQGIMTGVRDGGSNQDLFLRKDTVFKRSYAHSKLNKRLKEEMPNCGVGSLAELPQE
VKERIASMKGKDVELVVDKLLYATDVNAGNSRLSIPLRQVIAKNFLTDEEKRALIDDNCL
KVKILEPSLEMVSDMNLKQWNMFKKKGSVSSSYVFITHWNSLRRRSNLHRQDRIQVWSFR
VENDLYFALVKVGER
Download sequence
Identical sequences B9IDS4
POPTR_0015s01660.1|PACid:18233632 3694.eugene3.00150154 XP_002321417.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]