SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002425398.1.24195 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002425398.1.24195
Domain Number - Region: 602-689
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00366
Family Anti-sigma factor antagonist SpoIIaa 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002425398.1.24195
Sequence length 710
Comment Sulfate permease, putative [Pediculus humanus corporis]; AA=GCF_000006295.1; RF=representative genome; TAX=121224; STAX=121225; NAME=Pediculus humanus corporis; strain=USDA; AL=Scaffold; RT=Major
Sequence
MDKRSESTVALTSYVPCSEDLEGGGNGGSIGPNGFTNVAAIDENDKTRHEKKNDNEINNS
TNNNSNEILINVNSLRWNKDVEYDGGQKNENHSSNVDNHLKVKLSDYNQSNNLPRLTSFE
KNSSPKKWLCKKVKKCCTKKLLYKRVPILSWLPQYSLNYAVADLVAGLTVGLTVIPQAIA
YANVAGLPPQYGLYSSFMACFIYAIFGSVKDSPIGPTAIAAILTRENLHGLGPEFAVLLC
FLSGCVELLMGILQLGFLIDFISGPVSAGFTSAAAIIIATSQVKDVLGLSFPGGNFLDVW
ENIFCNISNTRMGDAILGISCMIVLLVLRKIKDIPIGPRDVKEKTKMQKFLSQFLWLVST
SRNIVVVVVCGILAYAFHVEGEDGPFVLTGTVKGGLPSFHIPFYGAVDGNKTYSFSEVSS
NLGSAILVVPLLCILENISLAKVFAKGKSIDATQEMLAIGLCNIASSFVGSMPVTGALSR
GAVNNASGVQTTFGGIYTGIIVILSLQFFTPYFYYIPKSSLAAVIIAAVVFMVEFHVVKP
MWKTKKIDLIPAFATFLSCLFIRLELGIVIGISINVLFLLYASARPSVQVEKERTLSGIE
YLRITPDRSLVFPSVDYVRNVVTKAGVKQGSSYVPVVIDSKHIQGVDFTAAKGIKSLMDD
FVNRKQPILFYNLKPSIVDIFHSLRPKEFIYCTNENELNDFLKQHHVAGT
Download sequence
Identical sequences E0VH04
vb|PHUM196650-PA|EEB12660.1|Sulfate XP_002425398.1.24195 121224.XP_002425398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]