SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002427420.1.24195 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002427420.1.24195
Domain Number 1 Region: 4-39
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000205
Family Retrovirus zinc finger-like domains 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002427420.1.24195
Sequence length 142
Comment conserved hypothetical protein [Pediculus humanus corporis]; AA=GCF_000006295.1; RF=representative genome; TAX=121224; STAX=121225; NAME=Pediculus humanus corporis; strain=USDA; AL=Scaffold; RT=Major
Sequence
MFDDRKKELNVQNARCQKCLELGHWTYQCKGKRKTLHQISRTTLLKKRLKAYEEENQKKL
MQAEKQKTDVNSKSKPSKKDISAGDNNSDDSTESDSESDSDSSSSSSDSSSSSISSSSSS
SDSSSSSSSSSSESEDSSGDTK
Download sequence
Identical sequences E0VMS6
vb|PHUM318530-PA|EEB14682.1|conserved XP_002427420.1.24195 121224.XP_002427420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]