SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002428698.1.24195 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002428698.1.24195
Domain Number 1 Region: 148-434
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.31e-67
Family Tandem AAA-ATPase domain 0.00067
Further Details:      
 
Domain Number 2 Region: 469-494
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000889
Family Retrovirus zinc finger-like domains 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002428698.1.24195
Sequence length 513
Comment predicted protein [Pediculus humanus corporis]; AA=GCF_000006295.1; RF=representative genome; TAX=121224; STAX=121225; NAME=Pediculus humanus corporis; strain=USDA; AL=Scaffold; RT=Major
Sequence
MAEAKKESAMEKQLKEEEKILESVAEKKALMGVAELAKGIQYADPIKTSWTAPKCILALG
EKRHNRVRNKLRILVEGEDIPPPIKDFKGMKFPEPLLVALQKRGIMRPTPIQIQGLPTVI
WTRHDWHRVYRKRENISFRSSTHNVLPGTRSLIICPSRELAKQTHDIFQYYCKSLLESGF
PEIRCCLGIGGVPVSESLEVIARGLHILVATPGRLMDMLDKKLIRLDVCRYLCMDEADRM
IDMGFEEDVRTIFSFFKGQRQTLLFSATMPKKIQNFARSALVKPITINVGRAGAASMNVI
QEVEYVKQEAKVVYLLECLQKTAPPVLIFAEKKQDVDAIHEYLLLKGVEAVAIHGGKDQE
ERSRSVEAFRSGKKDVLVATDVASKGLDFPDVQHVINYDMPDDVENYVHRIGRTGRSEKT
GIATTFVNKANDESVLLDLKHLLMEANQKVPLFLANLKSENEKYLDLGDERGCSYCGGLG
HRITNCPKLEAVQSKAASNIGRRDYLANNSADY
Download sequence
Identical sequences E0VRF4
XP_002428698.1.24195 vb|PHUM397370-PA|EEB15960.1|predicted 121224.XP_002428698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]