SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002429589.1.24195 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002429589.1.24195
Domain Number 1 Region: 275-324
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000157
Family Retrovirus zinc finger-like domains 0.0031
Further Details:      
 
Domain Number 2 Region: 222-269
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000407
Family Retrovirus zinc finger-like domains 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002429589.1.24195
Sequence length 380
Comment zinc finger protein cchc domain containing protein, putative [Pediculus humanus corporis]; AA=GCF_000006295.1; RF=representative genome; TAX=121224; STAX=121225; NAME=Pediculus humanus corporis; strain=USDA; AL=Scaffold; RT=Major
Sequence
MTRFARAKGSKSCNDKVPEQASSWAELKKSVELKTESNEELPGEIVNRIKSKPATKEPIK
WAPLDVDTVEIECDVEKKRQKKMSDSTNSKSESLEENSKPEKKKKKKLKKENSQGGNENK
TGNVKNAAATAAGNSKKVKSKNFKEKDKFPRKNNSDGTFVEEIMVNGEKVKVVKFQGFNV
THDDAVRLKELKTEMYKQGIPRDKLEAALKLERRRAEKSLSRLKKSVCFHCRGSGHVLSQ
CPSLTETENTGTGICYKCGSTEHSAIECKVVKGSSFQFAECFICKEQGHIARQCPDNPRG
LYPHGGACRECGDVTHLRKDCPKTVVKKEKETMTLGIRNDRNVETLEEEMVFNRGGGGGG
KTPTKKNGDVNGKRKSLVKF
Download sequence
Identical sequences E0VTZ5
XP_002429589.1.24195 121224.XP_002429589 vb|PHUM441140-PA|EEB16851.1|zinc

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]