SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002472294.1.31404 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002472294.1.31404
Domain Number 1 Region: 163-207
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000239
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002472294.1.31404
Sequence length 435
Comment predicted protein [Postia placenta Mad-698-R]; AA=GCF_000006255.1; RF=representative genome; TAX=561896; STAX=104341; NAME=Postia placenta Mad-698-R; strain=Mad-698-R; AL=Scaffold; RT=Major
Sequence
MSSTLSFLDQFNAPSTEGGKRLSIYTPKHTHLKAHNPEATNATDRAALEAYLSARREYDE
AVKAADEAIDHHKRLLRQQDDRVLTELIRLDNLKVAHRFQPLLPRSIRAQHNKFIPRAIP
NAYLPLPAPLPTSALRCPPIPPPFLQATPRSTTIPADWQPNPGWTPKGSCRRCGSSRHWV
RDCPDVRCAGCGKEAPGHLERECGTRPMKRHVSAPPEEPARRVGVVVDNAAARRGKCSAF
EIWSALSGDRAAFPIVEMLRLSPHPDRSGSVAETSPSCSPTAPDRSSPCAWLAERTFGDY
VSWRECTAGTEMNAAFHMCCCAIWVYFWPGWFLRWVDDARRTAGRGVVLVLRCQALVLCS
VWLWHPGLLAARENLTSCACVRAFWWRTVLATRQRGVSAPHANYGTWEHLAFKPLLSMDT
IVPLHTAAPYQFESP
Download sequence
Identical sequences B8P9D9
XP_002472294.1.31404 jgi|Pospl1|98588|fgenesh3_pg.53__89 104341.JGI98588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]