SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002473027.1.31404 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002473027.1.31404
Domain Number - Region: 183-227
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000239
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002473027.1.31404
Sequence length 385
Comment predicted protein [Postia placenta Mad-698-R]; AA=GCF_000006255.1; RF=representative genome; TAX=561896; STAX=104341; NAME=Postia placenta Mad-698-R; strain=Mad-698-R; AL=Scaffold; RT=Major
Sequence
MSSTLSFLDQFNAPSTEGGKRLSIYIPKHTHVSDSTLLMLLLSNPTDVFNKLKAHNPEAT
NATDRAALEAYLSARRDYDEAVKAADEAIDHHKRLLRQQDDRVLTELIRLDNLKVAHRFQ
PLLPCSIRVQHNKFIPRAIPNAYLPLPAPLPTSAFRRPPIPSPFLQATPRSTTIPADWQP
NPGWTPKGSCRRCRSSRHWVQDCPDIRCTGCGKEAPGHLERECGTRPMKRHVSAPPEEPA
RRVGVVVDNVFLEGIINEAKERKEKERQTKAVPIPPPRSTNPEPPTSPVAGPSRPRPDTP
VVFRKIDPDWTPDTTQWTWDSSWPNQKHLSGEEWTNVGRNARKEWFDEEEDDGVDWELYG
DGEHLHNGVRAHFVPGIVPLCFFLH
Download sequence
Identical sequences B8PBI7
XP_002473027.1.31404 jgi|Pospl1|103262|fgenesh3_pg.70__38 104341.JGI103262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]