SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002473759.1.31404 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002473759.1.31404
Domain Number 1 Region: 4-282
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.11e-77
Family Capz alpha-1 subunit 0.00000328
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002473759.1.31404
Sequence length 295
Comment predicted protein [Postia placenta Mad-698-R]; AA=GCF_000006255.1; RF=representative genome; TAX=561896; STAX=104341; NAME=Postia placenta Mad-698-R; strain=Mad-698-R; AL=Scaffold; RT=Major
Sequence
MNAAERLEAASKFLLQSPPGEINDVLNDVRNIISDDESLQEGVLPALREYNLAQFITADV
PGHNHHSIISAAARVVKADQEEGENIDRFWDPRSRTSFRFDHLSLETSEPEPYEPDAESE
PFRSALETSTLSYLGAHYHGGVASVFPAPQSTTRFFIQIVANKYNPSNFWSGRWRSEYIL
DLEEKQLKGKIQVNVHYYEQGNVQLSTTHDADLPLPPMITPSNTSSASKVLALIEAEEGK
YQASLSDAYAEMGEKTFKGLRRALPMTRSKLDWDKVLGYKLGAELTSGRGGFGAS
Download sequence
Identical sequences B8PDL6
jgi|Pospl1|90137|fgenesh3_pm.93__8 XP_002473759.1.31404 104341.JGI90137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]