SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002476493.1.31404 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002476493.1.31404
Domain Number - Region: 29-64
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00192
Family Retrovirus zinc finger-like domains 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002476493.1.31404
Sequence length 279
Comment predicted protein [Postia placenta Mad-698-R]; AA=GCF_000006255.1; RF=representative genome; TAX=561896; STAX=104341; NAME=Postia placenta Mad-698-R; strain=Mad-698-R; AL=Scaffold; RT=Major
Sequence
MTRLELKWQVTTGSIIGSNLAATSSATAFVTKSHGNSSKPRKTCSNCNMTGHEIADCFQL
GGAMEGKCAEVLTTKCPCLDKGKSGGSKVLHDPDGRMFMLSNTGDTMYIDTTASMASSSA
AKAPSTKFASLTVDTPDPVDLWAFPTLSPADTFKYSTLTRSLTDEDTASVDWGHHSSTAS
VTALATAAPAAAAALGTAPFFFDFSASTHLSPCKDNFSDLVAIAPHGIRGINGSVIYMHG
VSTIVLAIPIIALSLTWLRPTFYQGVNELCNSWDWCMWT
Download sequence
Identical sequences A0A1X6MJ47 B8PLE2
jgi|Pospl1|106043|fgenesh3_pg.220__10 XP_002476493.1.31404 104341.JGI106043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]