SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002477613.1.31404 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002477613.1.31404
Domain Number 1 Region: 186-215
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000244
Family Retrovirus zinc finger-like domains 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002477613.1.31404
Sequence length 218
Comment predicted protein [Postia placenta Mad-698-R]; AA=GCF_000006255.1; RF=representative genome; TAX=561896; STAX=104341; NAME=Postia placenta Mad-698-R; strain=Mad-698-R; AL=Scaffold; RT=Major
Sequence
MRKDLGKTWADAYYEKSAGGVQVYPDWAAFATALEEAFPEHGTRIKAHQILMKLPERQKN
KKTVLSLGNYVTRFEQLASKAQLKDAEVNGVNCTENDYHTLHANFVKGLPKELYVSLATR
VARDRPNTMKAWYDEVRNADAAEQGALTVTDTRDYGEPMDIDAAAVAATFASTSGGRKWE
LGAVLNEADRKLHRDRNLCFYCHIKGHSTKDCRKKAAA
Download sequence
Identical sequences B8PPK8
104341.JGI95445 jgi|Pospl1|95445|fgenesh3_pg.1137__1 XP_002477613.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]