SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002544408.1.76999 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002544408.1.76999
Domain Number 1 Region: 36-81,124-311,344-561
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.21e-56
Family AAT-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002544408.1.76999
Sequence length 597
Comment conserved hypothetical protein [Uncinocarpus reesii 1704]; AA=GCF_000003515.1; RF=representative genome; TAX=336963; STAX=33188; NAME=Uncinocarpus reesii 1704; strain=1704; AL=Scaffold; RT=Major
Sequence
MAPMPTEPPLPGSHDSDDLNRRRTAEPMLRPPHDFSRYYSCATRRRVASSVKDFYKYFAI
PGIHNLAGGLPHVSYFPFDSLEATVALPNRIPKDGFVPQPQPTASPASPPASQRVVVPKE
SSVDDGLRRIDLATALQYGAVDGYPPLRSFIRQFVRENLHPHVPYEGGPEVILTCGATDG
FSKTIEAFTNVWDENRDWIRERQGLLCEEFAYMTAIQTARPRGLNIVPVAVDSQGMKVEG
ERGLADVLDNWDFSRGQRPHLMYTVTIGQNPTGAVLPLERRRQIYKLCQRYDIIIIEDDP
YWHLQYPSAKQNALRQGQSDSSPHTPFSVHDEPSGFPFLDSLVKSYLSIDTAGRVVRLDT
FSKIIAPGCRLGWLTAQPDIVERILRISETSTQQPSGFVQSMVAKLIMGDQADDMVKKPC
TEGSPGWRVDGWVRWLEGLRGGYEKRMQTMCTILEEGRFSIVQGDALSNDSNLDEWQVVD
NVQMFDFDWPGAGMFVWVKFCLETHPLWSQVPAAKLANALWKYLINAPYRVIVGPGWLFA
PTEDVKKYAWRYMRLCFAPVDEGAVATSSHNFIEGCRSFWQVKDIHDIDDLEDDNEE
Download sequence
Identical sequences C4JM67
XP_002544408.1.76999 URET_03925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]