SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002552191.1.30775 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002552191.1.30775
Domain Number 1 Region: 123-454,493-545
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.91e-66
Family GABA-aminotransferase-like 0.0000847
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002552191.1.30775
Sequence length 552
Comment KLTH0B09306p [Lachancea thermotolerans CBS 6340]; AA=GCF_000142805.1; RF=representative genome; TAX=559295; STAX=381046; NAME=Lachancea thermotolerans CBS 6340; strain=CBS 6340; AL=Chromosome; RT=Major
Sequence
MRQPPEVLPSSIPVPEAVLRSSSYVWYYCQRAAHAIPGMRYVVSYVRKSHQDDPYRTLFE
LFLIIYGIIYFFRKPRKQGEQAAPKLSEREVEALLDEWEPEPIAQQNIKLEWRAKSTPVL
MGNSSAPTRVNLTRDEGRESYSDVLNCASTSFLQISSDPEFVKAAKDTIHQYGVGACGPA
GFYGNQDVHSELEYNLARFFGTERAVLYGQDFCIAASVIPAFTKRGDVIVADDRVNVALQ
NALQLSRSTVYYYNHNDMEALEELLEQLQERELNEKLPSLPRKFIVTEGLFQNLGDIPDL
PRLVELKRKYKYRLLVDETFSLGVLGANGRGIAEYYNMKRDASVDITIGSLAVALGSSGG
FVLGDNVMSMHQRIGSHAYTFSAALPAFAVTTASRVLDHLEHDNSAVQKLRSLSQLMHQL
FIDDSELSPYIEVTSSKESSILHFRLTDEYRSRVFHTTEESLFQELSAMHAKNLSEKYIE
GCEREEKLLQRIVDMALKEHKVLLTRNTFVLKHETLPVTPSLKLCCSAKMTEDELRSACE
SVKSAVLACTSE
Download sequence
Identical sequences C5DD92
XP_002552191.1.30775 559295.KLTH0B09306g gnl|GLV|KLTH0B09306g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]