SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002561420.1.37043 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002561420.1.37043
Domain Number 1 Region: 16-92,126-196
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000000000886
Family N-acetyl transferase, NAT 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002561420.1.37043
Sequence length 275
Comment Pc16g11150 [Penicillium rubens Wisconsin 54-1255]; AA=GCF_000226395.1; RF=representative genome; TAX=500485; STAX=1108849; NAME=Penicillium rubens Wisconsin 54-1255; AL=Scaffold; RT=Major
Sequence
MAVASVPITHGGSSMLKSVAALNGRAFDTDPVIAYMLLGMSQQERLAYLPTYWTALVKSA
LLNHAVITEADGWKAASVLIPPGGYIENVWTLLWAGFLGVLWKIGLPGVKRLWTEFSGMT
DNAKKNGLRGHTQYYYVFSIGTEREHRGKGLAKAIIQEHQKTAQAANLPIWLEATTTGSR
ALYLSMGFKEVEEIRLGKGKVAADASIQPHGPGVTLWAMVSFYLSIRLLLAYSNNSTNST
KKKHSPQETLCKLFKALRIRPALILPVRSVIILSL
Download sequence
Identical sequences B6H9K6
500485.B6H9K6 XP_002561420.1.37043 Pchr_Wisconsin_54-1255:Pc16g11150.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]