SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002563497.1.37043 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002563497.1.37043
Domain Number 1 Region: 3-127,162-198
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000000131
Family N-acetyl transferase, NAT 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002563497.1.37043
Sequence length 227
Comment Pc20g10030 [Penicillium rubens Wisconsin 54-1255]; AA=GCF_000226395.1; RF=representative genome; TAX=500485; STAX=1108849; NAME=Penicillium rubens Wisconsin 54-1255; AL=Scaffold; RT=Major
Sequence
MITNRPATLADIPQVRDINHWYIVNSCSTFATTPPPISHYEDILRDLMRRNLPFYVIVSD
TRKTPDGADLILGYAYLSPFRGHLLSYAPTVELSIFMRYDQQQFGYGTIILRKLLRLVQE
GEVEHRCEERVGDIPRIGFGSSMGVMKTSLVQNIIAIIPYDTEAPTDGERLRKWYMKWGF
IEKGQLENVGRKMGHWIDTVYLQWTMPEQTDDESEYPYDKDEDRKYA
Download sequence
Identical sequences B6HFK4
XP_002563497.1.37043 Pchr_Wisconsin_54-1255:Pc20g10030.t1 jgi|Pench1|38066|fgenesh1_pm.6_#_70 500485.B6HFK4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]