SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002568413.1.37043 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002568413.1.37043
Domain Number 1 Region: 1-162
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 5.66e-23
Family N-acetyl transferase, NAT 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002568413.1.37043
Sequence length 177
Comment Pc21g13960 [Penicillium rubens Wisconsin 54-1255]; AA=GCF_000226395.1; RF=representative genome; TAX=500485; STAX=1108849; NAME=Penicillium rubens Wisconsin 54-1255; AL=Scaffold; RT=Major
Sequence
MKIQIEPAQFPEDADSILSLFSDYATSLGIDLTFQSFQEELDSLPGKYAPSQGGALLIAR
VDTGVHEYDTDGLVDTIIPPQFPSALGCVALRRSSDGWCEMKRLYVLKEARGERLGEKLV
QAILAQARALGYRGMRLDTLPEMTAAQRLYRKYGFVDIAPYYDTPIQRTVFMGCELL
Download sequence
Identical sequences A0A167U8H1 B6HNS1
jgi|Pench1|66037|e_gw1.1.2402.1 Pchr_Wisconsin_54-1255:Pc21g13960.t1 XP_002568413.1.37043 500485.B6HNS1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]