SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002614368.1.3285 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002614368.1.3285
Domain Number 1 Region: 6-390
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.93e-94
Family IF2B-like 0.0000000669
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002614368.1.3285
Sequence length 402
Comment hypothetical protein CLUG_05854 [Clavispora lusitaniae ATCC 42720]; AA=GCF_000003835.1; RF=representative genome; TAX=306902; STAX=36911; NAME=Clavispora lusitaniae ATCC 42720; strain=ATCC 42720; AL=Scaffold; RT=Major
Sequence
MSKDTLEAIRFDKENVTLDILDQLLLPYESRYINIKSIQDAFEAIKSMQVRGAPAIAIVG
AFAITVDTHLYLKSGETSKTVADLLNSIDYLVTSRPTAVNLANACNEIKALLVSHFEKSD
LVTEKVWKLLFDYSVSLHEDDLRNNFKIGENGLRFISETLKAQNFKGPFSIVTVCNTGSL
ATSGHGTALGVIRTVHAQLSKSVSNEEFWFEHVYPLETRPYNQGAKLTTYELHYEKIPFT
MICDNMVTSLISTLHKKKNIKGSAAPVKFIITGADRVVKNGDSANKIGTYQLAAIADFFN
STFTKEEDKIKFMVAAPNTTIDLKTETGDEIVIEERPAHELTSLKGPVLREDGSVGEKMT
VGIATPGIQVWNPAFDVAPYQLIDCIVTEDEPFKKVDGKFSF
Download sequence
Identical sequences C4YC37
CLUT_05854 XP_002614368.1.3285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]