SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002660369.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002660369.1.45394
Domain Number 1 Region: 8-124
Classification Level Classification E-value
Superfamily Histone-fold 7.3e-43
Family Nucleosome core histones 0.000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002660369.1.45394
Sequence length 140
Comment histone H2A, sperm-like [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MSGRGKKLAAPQKSKTSVSRSARAGLQFPVGRIARLLRKGNFAARIGSGAAVYLTAVIEY
LCAEVLELAGNASRDNKKLRIAPRHIQLAVRNDEELNTLLGGVTISEGGVLPNIQAVLLP
KKTKAAREPNAGTEAQSQDF
Download sequence
Identical sequences Q7ZTT0
XP_002660369.1.45394 7955.ENSDARP00000012454 ENSDARP00000012454 ENSDARP00000012454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]