SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002668711.1.8020 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002668711.1.8020
Domain Number - Region: 279-355
Classification Level Classification E-value
Superfamily Colicin 0.0262
Family Colicin 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002668711.1.8020
Sequence length 412
Comment predicted protein, partial [Naegleria gruberi strain NEG-M]; AA=GCF_000004985.1; RF=representative genome; TAX=5762; STAX=5762; NAME=Naegleria gruberi; strain=NEG-M; AL=Scaffold; RT=Major
Sequence
MILSGCLLVWLSSYLVTEKAINDLSTKLINESGRKIITYLDGVMTPIAKLTKTMAREYTT
GVVTIPMFRNYLFPKFVEFRTTGCGFFFSVPLPSRYTYTISGTTSNPFPVFAYQPYGYPG
TIRDIVNITTGDIVKVNSTVDLTPYVPAKQDFFIYTLKNYYEKGLEGVYGEPYKVLGSTV
AIYYSQLMYDPEIYKLNKTKSLVGLAKVNLSLETIVNFLSKIELLGRGYVLVAQDNFIVI
GGSIDTISGDGLNSTNIFDVKSRNAGSLMKQFYELNNRTFSILPSVMKIVGESDGVSYII
TPYKYVLENMQWNIFFVLYESEVTEALILTTSISIGVTVGIIVLGIVGSFVTGLVVSRPM
KFLEKQFERIKVLDLGSVSNNSSMFREVNSIFNNLKNTVEWLAEIKTFIPQS
Download sequence
Identical sequences D2W4N4
jgi|Naegr1|76369|fgeneshNG_pg.scaffold_126000001 XP_002668711.1.8020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]