SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002686160.2.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002686160.2.76553
Domain Number 1 Region: 1820-2066
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.66e-52
Family Ankyrin repeat 0.0000000547
Further Details:      
 
Domain Number 2 Region: 911-954
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000536
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 3 Region: 412-536
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000011
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 948-992
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000152
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 5 Region: 594-724
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000033
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 1096-1229
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000102
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 7 Region: 783-915
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000251
Family Growth factor receptor domain 0.0099
Further Details:      
 
Domain Number 8 Region: 757-795
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000566
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 9 Region: 974-1105
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000022
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 10 Region: 146-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000794
Family EGF-type module 0.015
Further Details:      
 
Domain Number 11 Region: 1225-1273
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000107
Family EGF-type module 0.016
Further Details:      
 
Domain Number 12 Region: 532-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000352
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 13 Region: 260-307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000469
Family EGF-type module 0.018
Further Details:      
 
Domain Number 14 Region: 291-419
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000565
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 15 Region: 182-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000118
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 16 Region: 65-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000019
Family EGF-type module 0.013
Further Details:      
 
Domain Number 17 Region: 222-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000286
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 18 Region: 1264-1308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000044
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 19 Region: 716-759
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000786
Family EGF-type module 0.017
Further Details:      
 
Domain Number 20 Region: 1305-1344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000822
Family EGF-type module 0.014
Further Details:      
 
Domain Number 21 Region: 107-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000105
Family EGF-type module 0.01
Further Details:      
 
Domain Number 22 Region: 1376-1415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000142
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 23 Region: 1424-1456
Classification Level Classification E-value
Superfamily Notch domain 0.000000314
Family Notch domain 0.0016
Further Details:      
 
Domain Number 24 Region: 1503-1534
Classification Level Classification E-value
Superfamily Notch domain 0.000000667
Family Notch domain 0.0034
Further Details:      
 
Domain Number 25 Region: 28-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000482
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002686160.2.76553
Sequence length 2471
Comment PREDICTED: neurogenic locus notch homolog protein 2 isoform X1 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MPALRPAPLWALLALWLCRAAPARALQCRDGYEPCVNEGICVTYHNGTGYCKCPEGFLGE
YCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCAPGFTGEDCQHSTTHPCFVSHPCLNGGT
CHVLSRDTYECTCQVGFTGKLCQWTDACLSHPCANGSTCTTMANQFSCTCLAGFTGQKCE
TDVNECDIPGQCQHGGTCLNLPGSYQCQCPQGFTGQHCDSPYVPCAPSPCVNGGTCRQTG
DFTFECSCLPGFEGVTCERNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVD
ECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASF
SCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGSDCTEDVDECA
MANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCKNDATCLDKIGGFTC
LCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYM
GAICSDQIDECYSSPCLNEGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASNPCVHGVCM
DGVNRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINDVNGFRCICPEGPHHPSCYSQ
VNECLSNPCVHGNCTGGLTGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYR
CTCKKGFKGYNCQVNIDECASNPCLNQGTCLDDVSGYTCHCVLPYTGKNCQTVLAPCSPN
PCENAGVCKEAPNFESYSCLCAPGWQGQRCTIDIDECVSKPCMNHGLCHNTQGSYMCECP
PGFSGMDCEEDIDDCLANPCQNGGSCVDGVNTFSCLCLPGFTGDKCQTDMNECLSEPCKN
GGTCSDYVNSYTCKCPAGFDGVHCENNIDECTESSCFNGGTCIDGINSFSCLCPVGFTGS
FCLHEINECNSHPCLNEGVCVDGLGTYRCICPLGYTGKNCQTLVNLCSRSPCKNKGTCIQ
DKAESRCLCPSGWAGAYCDVPSVSCEVAASHRGVPVDRLCQHSGVCISAGNSHHCQCPLG
YTGSYCEDQLDECSSNPCQHGATCRDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGG
TCIDLVNHFKCSCPPGTRGLLCEENVDDCARGPHCLNGGQCVDRIGGYSCRCLPGFAGER
CEGDINECLSNPCSSEGSLDCIQLTNDYLCVCRSTFTGRHCETFVDVCPQMPCLNGGTCA
VASNMPDGFICRCPPGFSGARCQSSCGQVKCRRGEQCVHTASGPRCFCPNPQDCDSGCAS
SPCQHGGSCYPQRQPPYYSCQCAPPFRGSHCELYTAPTSTPPATCLSQYCADKARDGICD
DVCNSHACQWDGGDCSLTMEDPWANCSSPLPCWEYINNQCDELCNTAECLFDNFECQKSS
KTCKYDKYCADHYEDNHCDQGCNSEECGWDGLDCAADRPENLAEGTLVIVVLMPPEQLLQ
DARRFLRALGTLLHTNLRIKRSAQGELMVYPYYGGKSAAMKKQRLTRRSLPGDEEQEVAG
SQVFLEIDNRQCVQDSDQCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLTPKPTQLLY
LLAVAVVIILFIILLGVIMAKRKRKHGSLWLPEGFTLRRDSSNHKRREPVGQDAVGLKNL
SVQVSEANLIGSGTSEHWVDDEGPQPKKAKAEDEALLSEEDDPIDRRPWTQQHLEAADIR
RTPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDMSDEDEDAEDSSANIIT
DLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAA
DAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSA
LHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITD
HMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVICGPNRPFLSLKHTPMG
KKSRRPNTKSTVPTSLPNLAKEAKDAKGNRRKKSLSDKGQLSESSVTLSPVDSLESPHTY
VSDTTSSPMITSPGILQASPNPMLATAAPTAPVHAQHALSFSNLHEMQPLAHGANTVLPS
VSQLLSHRHIVPPGSSTAGSLGRLHSVTVPADWMNRVEMNESQYNEMFGMVLAPAEGTHP
GIAPQSRPPEGKHLTTPREPLPPIVTFQLIPKGSIAQPTGAAQPPSNCPPAVAGTLPTMY
QIPEMARLPSMAFPTAMMPQQDGQVAQTILPAYHAFPASVGKYPTPPSQHSYASSNAAER
TPSHSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGGGQRGPGTHMS
EPPRSNMQVYA
Download sequence
Identical sequences F1MPE9
ENSBTAP00000010400 XP_002686160.2.76553 XP_872335.5.59421 ENSBTAP00000010400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]