SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002722023.1.1745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002722023.1.1745
Domain Number 1 Region: 29-146
Classification Level Classification E-value
Superfamily FKBP-like 3.93e-28
Family FKBP immunophilin/proline isomerase 0.00017
Further Details:      
 
Domain Number 2 Region: 168-317
Classification Level Classification E-value
Superfamily TPR-like 1.37e-21
Family Tetratricopeptide repeat (TPR) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002722023.1.1745
Sequence length 327
Comment PREDICTED: inactive peptidyl-prolyl cis-trans isomerase FKBP6 [Oryctolagus cuniculus]; AA=GCF_000003625.3; RF=representative genome; TAX=9986; STAX=9986; NAME=Oryctolagus cuniculus; breed=Thorbecke inbred; AL=Chromosome; RT=Major
Sequence
MSGFARPRNGMAPSGEDCLSVYQRLSQRMLDISGDRGVLKDVIREGVGELVTPDASVLVK
YSGYLEHMDKPFDSNCFRKSPRLMKLGEDITLWGMELGLLSMRRGELARFLFTPTYAYGA
LGCPPLIPPNTTVLFEIELLDFLDSAESDTFCALSAEQQDQFPLQKVLKVAATEREFGNY
LFRQNRFCDAKARYKRALLLLHRRSAAPGEQHLVEAAKLLVLLNLSFTYLKLERPAPALC
YGEQALDIDNKNTKALFRCGQACLLMTEYEKARDFLVRAQKQQPFNHDINSELKKLASCY
KDYTDREREMCHRMFAPCADGPAMAQH
Download sequence
Identical sequences G1TMB9
ENSOCUP00000018127 ENSOCUP00000018127 9986.ENSOCUP00000018127 XP_002722023.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]