SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002726994.2.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002726994.2.4139
Domain Number 1 Region: 5-108
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.15e-34
Family Calponin-homology domain, CH-domain 0.0000675
Further Details:      
 
Domain Number 2 Region: 160-190
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000198
Family LIM domain 0.024
Further Details:      
 
Domain Number 3 Region: 191-219
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000278
Family LIM domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002726994.2.4139
Sequence length 855
Comment PREDICTED: MICAL-like protein 1 isoform X2 [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MAGPRGALLAWCRRQCEGYRGVDIRDLSSSFRDGLAFCAILHRHRPDLLDFQSLSKENVF
ENNRLAFEVAEKELGIPALLDPNDMVSMSVPDCLSIMTYVSQYYNHFTSSGQAAASPPKP
GKDPAAPSPTSTSPAVQPGEEAQGDDLSPDSLSEQGKPQPPSSACAACGQRVHLVQRYLA
EGRLYHRHCFRCRQCSSTLVPGSYSSGPEEGTFVCAERCTRLGLGGRSGTRPLSLQKQQP
AAAAEAKDGEDSDLSKSVVVVAAEADGLQASSEVQPHTLTKPPLPSKPQDLASPPVSRPT
PAPRKASESSALTPPTPRPRSSLQQDGMVEQSVSGDLVNGRLQELPVPKPRGTPKLSERM
TAPRKDPPWITLVQTEPKKKPAPLPPSSGPGPLSQASRQVENGGLEEKTQKSPAAEPEPK
PYNPFEEEEEEEEASVPAVPSPAPAPPETTPKSLHPWYNITPTSSPKTKKRPAPKAPSAS
PLVLHASRLSHSEPPSATPSPALSVESLSSESSSHTANTEPSEPPAVPKSSSDPAVHVPG
TPGTSANSVTPSAHSSLSSSGELGQPSGEQMPQARTRGSPGTHSTKPFSGATPTPFLLAG
DQKSPAPPMGSSSPQMLIKSSCKENPFNRKPSPSTSPTVRKATKGAKPVRPPAPGHGFPL
IKRKVQADQYIPEEDIYGEMDSIERQLDALEHSGVLLEEKLRGGANEGSEDDMLVDWFKL
IHEKHLLVRRESELIYVFKQQNLEQRQADVEFELRCLLNKPEKDWTDDDRAREKVLMQEL
MTLIEQRDAIVNCLDEDRQREEEEDKMLETMIKKKDFQREAESDSKKKGKFKTMKVLKLL
GNKRDAKSKAPTGKS
Download sequence
Identical sequences D3ZQL6
XP_002726994.2.4139 XP_002729878.2.100692 10116.ENSRNOP00000034618 ENSRNOP00000034618 ENSRNOP00000034618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]