SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002742893.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002742893.1.60252
Domain Number 1 Region: 14-496
Classification Level Classification E-value
Superfamily ALDH-like 4.71e-184
Family ALDH-like 0.0000000000000411
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002742893.1.60252
Sequence length 501
Comment PREDICTED: retinal dehydrogenase 1 [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MSSSDVPDLPALLTDLKIQYTKIFINNEWHNSVSGKKFPVFNPATEEELCQVEEGDKEDV
DKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLMERDRLLLATMESMNGGKLYSDAYL
NDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQILPWNFPLFMLVWKI
GPALSCGNTVIVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDID
KIAFTGSTEVGKIIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGLFYHQG
QCCIAASRLFVEESIYDEFVRRSVERAKKYVLGNPLTPGVTQGPQIDKEQYDKILDLIES
GKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKR
ANNTFYGLSAGIFTKDIDKAITISSALQAGTVWVNCYGVISAQSPFGGFKMSGNGRELGE
YGLHEYTEVKTVTVKISQKNS
Download sequence
Identical sequences F7IE41
ENSCJAP00000002372 ENSCJAP00000002372 XP_002742893.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]