SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002747097.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002747097.1.60252
Domain Number 1 Region: 7-486
Classification Level Classification E-value
Superfamily ALDH-like 2.09e-161
Family ALDH-like 0.0000000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002747097.1.60252
Sequence length 487
Comment PREDICTED: aldehyde dehydrogenase family 8 member A1 [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MAATKALLMLENFIDGKFLPCSSYIDSYDPSTGEVYCRVPNSGKDEIEAAVKAAREAFPG
WSSRSPQERSRVLNQVADLLEQSLEEFAQAESKDQGKTLALARTMDIPRSVQNFRFFASS
ILHHISECTQMDHLGCMHYTVRTPVGVAGLISPWNLPLYLLTWKIAPAMAAGNTVIAKPS
ELTSVTAWMLCRLLDEAGVPPGVVNIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERIT
QLSAPHCKKLSLELGGKNPAIIFEDANLDECVPATVRSSFANQGEICLCTSRIFVQKSIY
REFLKRFVEATREWKVGIPSDPLASMGALISKAHLEKVRSYVKKALAEGAQIQCGEGVDK
LSLPARNQAGYFMLPTVITDIRDESCCMTEEIFGPVTCVVPFDSEEEVIERANSLKYGLA
AVVWSSNVGRVHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSYDFFTEI
KTITIKH
Download sequence
Identical sequences F7HZS8
XP_002747097.1.60252 ENSCJAP00000014208 ENSCJAP00000014652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]