SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002751816.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002751816.1.60252
Domain Number 1 Region: 8-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.11e-114
Family Capz alpha-1 subunit 0.000000000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002751816.1.60252
Sequence length 286
Comment PREDICTED: F-actin-capping protein subunit alpha-2 isoform X2 [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MADLEEQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLD
QFTPVKIEGYEDQVLITEHGDLGNGKFLDPKNRICFKFDHLRKEATDPRPCEVENAIESW
RTSVETALRAYVKEHYPNGVCTVYGKKIDGQQTIIACIESHQFQAKNFWNGRWRSEWKFT
ITPSTTQVVGILKIQVHYYEDGNVQLVSHKDIQDSLTVSNEVQTAKEFIKIVEAAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences A0A2K5RAE6 Q07DV7 Q09YH6 Q09YL0 Q2QLG4 U3DUR6
ENSCJAP00000009356 XP_002751816.1.60252 XP_017390550.1.71028 ENSCJAP00000009374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]