SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002761514.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002761514.1.60252
Domain Number 1 Region: 285-649
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.8e-62
Family Quinoprotein alcohol dehydrogenase-like 0.027
Further Details:      
 
Domain Number 2 Region: 30-228,280-370
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 3.14e-24
Family SGL-like 0.044
Further Details:      
 
Weak hits

Sequence:  XP_002761514.1.60252
Domain Number - Region: 582-633,688-731
Classification Level Classification E-value
Superfamily Peptidase/esterase 'gauge' domain 0.00136
Family Prolyl oligopeptidase, N-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002761514.1.60252
Sequence length 918
Comment PREDICTED: periodic tryptophan protein 2 homolog isoform X4 [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MKFAYRFSNLLGTVYRRGNLNFTFDGNSVISPVGNRVTIFDLKNNRSDTLPLATRYNIQC
VGLSPDGRLAIIVDEGGDALLVSLVCRSVLHRFHFKGSVHSVSFSPDGRKFVVTKGNIAQ
MYHAPGKKREFNAFFLDKTYFGPYDETTCIDWTDDSRCFVVGSKDMSTWVFGAERWDNLI
YYALGGHKDAIVACFFESSSLDLYSLSQDGVLCVWQCDTPPEGLRLKPPAGWKADLLQRE
EEGEENQEGDRETTIQGKATPAEEEKTGKVKYSRLAKYFFNKEGDFNNLTAAAFHKKSHL
LVTGFASGIFHLHELPEFNLIHSLSISDQSIASVAVNSSGDWIAFGCSGLGQLLVWEWQS
ESYVLKQQGHFNSMVTLAYSPDGQYIVTGGDDGKVKVWNTLSGFCFVTFTEHSSGVTGVT
FTATGYVVVTSSMDGTVRAFDLHRYRNFRTFTSPRPTQFSCVAVDASGEIVSAGAQDSFE
IFVWSMQTGRLLDVLSGHEGPISGLCFNPMKSILASASWDKTVRLWDMFDSWRTKETLAL
TSDALAVTFRPDGAELAVATLNSQITFWDPENAVQTGSIEGRHDLKTGRKELDKITAKHS
AKGKAFGTLCYSADGHSILAGGMSKFVCIYHVREQILMKRFEISCNLSLDAMEEFLNRRK
MTEFGNLALIDQDAGQEDGVAIALPGVKKGDMSSRHFKPEIRVTSVRFSPTGRCWAATTT
EGLLIYSLDTRVLFDPFELDTSVTPRRVREALRQQDFTRAILMALRLNESKLVQEALEAV
PRDEIEVVSSSLPELYVEKVLEFLASSFEVSRHVEFYLLWTQKLLMLHGQKLKARATTLL
PVIQFLQKSIQRHLDDLSKLCGWNRYNMQYALAVSQQRGTKRPLEPLGSEEEEAEASEDN
SLQLLGGAGRDSEEEMLA
Download sequence
Identical sequences F6V9M8
ENSCJAP00000010226 ENSCJAP00000010226 XP_002761514.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]