SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002822941.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002822941.1.23681
Domain Number 1 Region: 80-222
Classification Level Classification E-value
Superfamily C-type lectin-like 6.65e-34
Family C-type lectin domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002822941.1.23681
Sequence length 229
Comment PREDICTED: C-type lectin domain family 1 member B isoform X1 [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MQDEDGYITLNIKTRKPALVSVGPASSSWWRVMALILLILCVGMVVGLVALGIWSVMQHN
YLQDENENRTGTLQQLAKRFCQYVIKQSELKGTFKGHKCSPCDTNWRYYGDSCYGFFRHN
LTWQESKQYCTDMNATLLKIDNQNIVEYIKARTSLIRWVGLSRQKSNEVWKWEDGSGISE
NMYEFLEDGKGNMNCAYFHNGKMHPTFCENRHYLMCERKAGMTKVDQLP
Download sequence
Identical sequences H2NGH1
ENSPPYP00000004862 ENSPPYP00000004862 9600.ENSPPYP00000004862 XP_002822941.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]