SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002827876.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002827876.1.23681
Domain Number 1 Region: 43-242
Classification Level Classification E-value
Superfamily Ribosomal protein S7 1.44e-48
Family Ribosomal protein S7 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002827876.1.23681
Sequence length 250
Comment PREDICTED: 28S ribosomal protein S7, mitochondrial [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MGSSWPAKMAAPAVKVARGWLGLALGVRPAVLQLPGLTQVRWSRYNPEFKDPLIDKEYYR
KSVEELTEEEKYDRELKKTQLIKAAPAGKTSSVFEDPVISKFTNMMMIGGNKVLARSLMT
QTLEAVKRKQFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPILKGGRFYQVPV
PLPDRRRRFLAMKWMITECRDRKHQRTLMPEKLSHKLLEAFHNQGPVIKRKHDMHKMAEA
NRALAHYRWW
Download sequence
Identical sequences H2NUP6
ENSPPYP00000009683 XP_002827876.1.23681 ENSPPYP00000009683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]