SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002831846.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002831846.1.23681
Domain Number 1 Region: 37-130
Classification Level Classification E-value
Superfamily FKBP-like 4.25e-29
Family FKBP immunophilin/proline isomerase 0.00000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002831846.1.23681
Sequence length 131
Comment PREDICTED: peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 isoform X1 [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKS
GMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKF
GYHIIMVEGRK
Download sequence
Identical sequences H2PW04 Q9Y237
ENSNLEP00000022013 ENSPPYP00000022907 ENSPPYP00000022907 XP_002813636.2.23681 XP_002831846.1.23681 XP_003280920.1.23891 XP_010330700.1.74449 XP_012291037.1.9421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]