SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002833133.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002833133.1.23681
Domain Number 1 Region: 284-570
Classification Level Classification E-value
Superfamily Kelch motif 1.96e-65
Family Kelch motif 0.00014
Further Details:      
 
Domain Number 2 Region: 11-129
Classification Level Classification E-value
Superfamily POZ domain 6.02e-33
Family BTB/POZ domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002833133.1.23681
Sequence length 581
Comment PREDICTED: kelch-like protein 38 [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MDKESPDGLLFKDQDFSSDLLRQLNCLRQSRILTDVSICAGAQEIPCHRNVLASSSPYFR
AMFCSSFREKSEAKVQLKGIDPPTLDQIISYVYTGEARIAADNVLPVMEAASMLQFPKLF
EACSSYLQSQLAPSNCLGMIRLSEVLSCETLKKKAREVALTSFPEVAASADLKELCALEL
RDYLGDDGLCGEEEKVFEALMVWIKHDLQARKRYIQELFKQVRLQYIHPAFFHHFIASDA
LLQSSPACQIILETAKRQMFSLCGTSAPDCKLLLHVPPRNSYQDFLILLGGRKDSQQTTR
DVLLYSKQTGQWQSLAKLPTRLYKASAVTLHRSVYVLGGMAVSSGRSLVSHNVYIFSLKL
NQWRLGEPMLVARYSHRSTAYKNFIFSIGGIGEGQELMGSMERYDSICNVWESMASMPVG
VLHPAVAVKDQRLYLFGGEDIMQNPVRLIQVYHISRNSWFKMETRMIKNVCAPAVVLGER
IVIVGGYTRRILAYDPQSNKFVKCADMKDRRMHHGATVMGNKLYVTGGRRLTTDCNIEDS
SSFDCYDPETDTWTSQGQLPHKLFDHACLTLQCIPRTSALP
Download sequence
Identical sequences H2PRL0
9600.ENSPPYP00000021320 XP_002833133.1.23681 ENSPPYP00000021320 ENSPPYP00000021320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]