SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002867283.1.15461 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002867283.1.15461
Domain Number 1 Region: 9-109
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-20
Family B3 DNA binding domain 0.0031
Further Details:      
 
Domain Number 2 Region: 157-250
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.73e-19
Family B3 DNA binding domain 0.006
Further Details:      
 
Domain Number 3 Region: 284-389
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000942
Family B3 DNA binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002867283.1.15461
Sequence length 394
Comment hypothetical protein ARALYDRAFT_913296 [Arabidopsis lyrata subsp. lyrata]; AA=GCF_000004255.2; RF=representative genome; TAX=81972; STAX=59689; NAME=Arabidopsis lyrata subsp. lyrata; AL=Scaffold; RT=Minor
Sequence
MVNHPLQSPANPHFFQPLLPGSETHLSIPVTFFSKHIEGKNEQKTARLISDASDRIWQVK
MDGRRLTEGWKEFATAHNLQIGDIIIFKHQGDMLFSVTPFGPSCCEIQYVQCLIKKEDDN
VHDDEDDMENQHNSRKGLRQKNLKPKTELKLSLSYDYCFVANVTASNLKFDTMNLPKKAS
SSKALNKRCHKIILVNKEGNSWTLNLRFRESEGSYYIRGGWKRFCSENRQKEGDLITFNL
VGDGRSTPMLCICPEEACSELMGIARGKKKTKKRRMWVASSSSRQNSFVTLSLTAYNIKY
SKINLPVEFTKINGITRKHEKIILMDKHGVKRLTRLVHDGPNYGRRGLGKGWKLFCEAND
VLKIGEPFKLKLTWENNTPLLRFCSKVKEEPIYV
Download sequence
Identical sequences D7MB37
XP_002867283.1.15461 jgi|Araly1|913296|scaffold_701038.1 59689.scaffold_701038.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]