SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002883165.1.15461 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002883165.1.15461
Domain Number 1 Region: 120-218
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.1e-24
Family B3 DNA binding domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002883165.1.15461
Sequence length 275
Comment DNA binding protein [Arabidopsis lyrata subsp. lyrata]; AA=GCF_000004255.2; RF=representative genome; TAX=81972; STAX=59689; NAME=Arabidopsis lyrata subsp. lyrata; AL=Scaffold; RT=Minor
Sequence
MVESELSYEQIRLKRVEENKKRMGELNLNKLAQSLRVSSSSSKPSPAKPRTMRIPVDFSE
VRRSSRAKGPPPSYKEFGLEPLERRPRRSSQRRDLLNRVYASDDARMYAFDRAEKLQSSL
DPEFPSFTKPMLQSHVTGGFWLGLPLPFCKAHMPKRDEMMTLVDEEDEESMVKYLAEKNG
LSGGWRGFAIDHQLVDGDAVVFQLITRTMFKVYIIRVNEDANKDSDGNEEDEDNDNELNK
KQKENVSEARQLRSSGKRKRGGNNVSNLSLPLVIS
Download sequence
Identical sequences D7L985
59689.fgenesh2_kg.3__2134__AT3G19184.1 jgi|Araly1|479433|fgenesh2_kg.3__2134__AT3G19184.1 XP_002883165.1.15461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]