SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002893387.1.15461 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002893387.1.15461
Domain Number 1 Region: 742-840
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-20
Family B3 DNA binding domain 0.0068
Further Details:      
 
Domain Number 2 Region: 263-364
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-19
Family B3 DNA binding domain 0.0065
Further Details:      
 
Domain Number 3 Region: 627-725
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.63e-19
Family B3 DNA binding domain 0.0062
Further Details:      
 
Domain Number 4 Region: 11-111
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.9e-18
Family B3 DNA binding domain 0.0042
Further Details:      
 
Domain Number 5 Region: 448-548
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.85e-18
Family B3 DNA binding domain 0.0096
Further Details:      
 
Domain Number 6 Region: 151-249
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000608
Family B3 DNA binding domain 0.0083
Further Details:      
 
Domain Number 7 Region: 899-997
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000275
Family B3 DNA binding domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002893387.1.15461
Sequence length 1003
Comment T24P13.6 [Arabidopsis lyrata subsp. lyrata]; AA=GCF_000004255.2; RF=representative genome; TAX=81972; STAX=59689; NAME=Arabidopsis lyrata subsp. lyrata; AL=Scaffold; RT=Minor
Sequence
MADQSLLHSPIKPHFFKPLLQGFRTHLNIPVAFFSKHVEGKNDQNKIAKLRSDASEKTWL
VKMDGLNLTDGWEDFAFAHDLRIGDIVIFRHEGEMVFHVTALGPSCCEIQYYTSSHNSND
DDRNDQTNIASRNSERVKKNPRKKVESSLDHSRFVAKVSAWGLRNDRLYIPLSFARSNGL
NKINSKKIYLYNEAGRSWKLDLKHDKSGMHTYIQSGWRSFCAANGIRQGQYTFKLVRKSA
PSLIRLCREKAKPKQRSVAESSSDQSCFEGSVSPSSLRNNQLFLPRSFVSSNSLEKRCSE
IVLKNEQGIKWPSVLKHYKTVTYLTKGWTSFCQVNRIKAGDSYKFKLVGTWTKPVLSLCP
TNSNHDKTPLECPNDVKTLSSNPRSGDDSSKSKEIEEENIEDKNISKTCLEIKKRKYWSR
CRASVENMDDDQTNIGNSSRKNVESSSYHSSFEGSVNPSSLYKDQLYLPRNFVSSNGLDK
RCSEIVLKNERGEKRTLVLKHFKQNLTFLKKGWTSFCQVNRIKAGDSFKFKLVGTWNKPV
LTLCPTVSNHHKTPLECSEGNKSEENEEEDIKDKNTSQDCLEVKKRKYWSKCRASAENMD
DDQTNIGSSSRKKRVKKNPIKKADSSSDHSSFVANVTASSLNCDRLYLPLGFARSNGLDK
MSGKKVVLLNEEGRTWKLNLKYNKAGNQTYVRPGWKRFCDANGMSQDQQFTFKLVQKHGP
PVMRLYLAEHRPKSESSSHGSYLVGSVTASSINKDKLYLRKSFVSSNGLDKGCKKIVLKN
EWGREWNLVFRHYKSHCFTIIKRGWASFCQGNGLKAGDSFKFKLVGTGEKPVLSLCPAES
SCECPDGSDDVKSLSSNSSSGDDSSRSEEVEEESMEDKNISQDCLEIKKRKYCCSSSYSQ
NRFVTLTLTLSAFQTYKLYLPRGFTQVNGINKPRKITLLGQDGVKRVVDLYQDKISGTMR
FGKGWRESCEAQGVKIDESFVLELIWEKEASPVLKFCTKLNSA
Download sequence
Identical sequences D7KQM9
jgi|Araly1|890070|scaffold_102864.1 59689.scaffold_102864.1 XP_002893387.1.15461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]