SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002995790.1.67189 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002995790.1.67189
Domain Number 1 Region: 120-175
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.06e-16
Family PHD domain 0.00089
Further Details:      
 
Weak hits

Sequence:  XP_002995790.1.67189
Domain Number - Region: 20-106
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0706
Family Capz beta-1 subunit 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002995790.1.67189
Sequence length 177
Comment hypothetical protein NCER_101229 [Nosema ceranae BRL01]; AA=GCF_000182985.1; RF=representative genome; TAX=578460; STAX=40302; NAME=Nosema ceranae BRL01; strain=BRL01; AL=Contig; RT=Major
Sequence
MNIFETYDKLIENIQQIPLDVYLFIRKNTRINLKLDKLINKYNKLLKYTYRGYSVDEEKI
KKLSTKIFKLRKVLIDSSDVLKKVLLDLQEKSDKICNMNYENNLLPKLDIENINRIVKVG
RYKEHGPYYCICKQKAYDNMIACNNTNCRIKWFHFVCAGITLPPKSVWYCTECKKMK
Download sequence
Identical sequences A0A0F9WTC2 C4V9I2
XP_002995790.1.67189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]