SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003036856.1.72525 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003036856.1.72525
Domain Number 1 Region: 126-527
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.32e-105
Family GABA-aminotransferase-like 0.0000000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003036856.1.72525
Sequence length 645
Comment aminolevulinic acid synthetase [Schizophyllum commune H4-8]; AA=GCF_000143185.1; RF=representative genome; TAX=578458; STAX=5334; NAME=Schizophyllum commune H4-8; strain=H4-8; AL=Scaffold; RT=Major
Sequence
MGPALDVRGKQLAAGYASVAGQADVEKIHQDQGITIPPNATVEMCPHAKAARDAARIAED
LAAAAASKQQPAKKAGGCPFHAAQAQAQAKPAAAPKETVATADKKGKSPRAAGGFDYEKF
YEEELDKKHQDKSYRYFNNINRLAARFPTAHTAKVTDEVEVWCSNDYLGMGGNPVVLETM
HRVLDKYGHGAGGTRNIAGNGALHLSLEQELARLHRKEGALVFTSCYVANDATLSTLGSK
MPGCVIFSDRMNHASMIQGIRHSGTKKVIFEHNDLADLEKKLAEYPKETPKIIAFESVYS
MCGSIGPIKEICDLAEKYGAITFLDEVHAVGLYGPRGAGVAEHLDYDLHKAAGDSPDAIP
GTVMDRVDIITGTLGKSYGAIGGYIAGSARFVDMIRSYAPGFIFTTSLPPATVAGAQASV
VYQKEYLGDRQLKQVNVREVKRRFAELDIPVVPGPSHIVPVLVGDAALAKQASDKLLAEH
DIYVQAINYPTVARGEERLRITVTQRHTLEQMDHLIGAVDQVFNELNINRVQDWKRLGGR
ASVGVPGGQDFVEPIWTDEQVGLADGSAPLTLRNGQPNEVSHDAVVAARSRFDWLLGPIP
SHIQAKRLGQSLEGTPIAPLAPKQSSGLKLPVEEMTMGQTIAVAA
Download sequence
Identical sequences D8PKJ2
jgi|Schco1|72395|estExt_Genewise1.C_11606 XP_003036856.1.72525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]