SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003038807.1.72525 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003038807.1.72525
Domain Number 1 Region: 178-561,599-651
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.26e-83
Family GABA-aminotransferase-like 0.0000289
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003038807.1.72525
Sequence length 683
Comment hypothetical protein SCHCODRAFT_64875 [Schizophyllum commune H4-8]; AA=GCF_000143185.1; RF=representative genome; TAX=578458; STAX=5334; NAME=Schizophyllum commune H4-8; strain=H4-8; AL=Scaffold; RT=Major
Sequence
MALPRATPTPSRFKRAHTSAQEYLRAIASRESGGARHSAPSVSSDASSVASVSTYASYAS
TSKTSVSPSCASEDHGSEWDSAADPLGFSRDKEADAHATPHSEYGICNDERWRYESSYRG
TPPSEGIADPPYYILLSTYISFIFVIALGHLADWMDRMRYGSVYGKSEETGLAPLTADFD
SFYTRRLKRRLLECFNQPSTGVAGRTIRILDRYSPDWNKSQILTGTTTRTLNISSYNYLG
FAQAQGGCAEGVEAGLHRYGISTCGTRAEGGSSELHVTAERLVANFVGTEDSLISSMGFA
TNSTVIPALVGKGCLIISDELNHSSIRFGARLSGAHVRLFKHNDIKELERVLRDAISQGQ
HKTHRPWRKILVIVEGLYSMEGTMVDLPGIMALKTRYKFYLFVDEAHSIGALGPHGRGVC
DYYEIIPGTNVDILMGTFTKSFGAAGGYIAGSHQIIEYLRVNGHGGVYAEAMTPPVLIQI
ITSMASIMGVVPDMQTPKKHSQQLVKAPAHPGLEGNVRLRRLAFNSRYLSRGLNALGFIT
CGHDDSPVVPLIIWSPGKMVQFHRLMLQWRDGWNRGIDGRMVCMAAAGESQEAGGDDAVR
NAWGARTPILTVVVSYPATPLITSRVRFCVSAAHTKQDMDIVLRACDQIGDWLDLKHGIP
PSKRWNIDDIVENAADLVQAETF
Download sequence
Identical sequences D8PSA1
jgi|Schco1|64875|estExt_Genewise1Plus.C_13631 XP_003038807.1.72525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]