SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003066395.1.1890 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003066395.1.1890
Domain Number 1 Region: 91-139
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000000775
Family Retrovirus zinc finger-like domains 0.0028
Further Details:      
 
Weak hits

Sequence:  XP_003066395.1.1890
Domain Number - Region: 3-34
Classification Level Classification E-value
Superfamily MIT domain 0.0471
Family MIT domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003066395.1.1890
Sequence length 193
Comment zinc knuckle containing protein [Coccidioides posadasii C735 delta SOWgp]; AA=GCF_000151335.1; RF=representative genome; TAX=222929; STAX=199306; NAME=Coccidioides posadasii C735 delta SOWgp; strain=C735 delta SOWgp; AL=Scaffold; RT=Major
Sequence
MPEEAWAILKKASDERDLEDFREALKIYSKAVPLATFDEIEKKFRADNFKIYLIGLSATS
PKIALRKVSTAELVAIAGKEEGHMSKECDKPRNMDNVTCRNCEKTGHMSRDCPEEKDWSK
VQCTNCKEMGHTFRRCNKPAEGADSDNADSYGGFYGAGIGSKNHHDQTRGRKETTAQSAG
NWYEEPTDGGAGW
Download sequence
Identical sequences C5PI97
222929.C5PI97 XP_003066395.1.1890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]